bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0015_orf2 Length=110 Score E Sequences producing significant alignments: (Bits) Value CE13720 29.3 2.0 Hs6806882 28.9 2.4 Hs4502117 28.9 2.4 Hs14785908 28.9 2.4 7290075 28.9 2.8 CE26240 28.5 2.9 CE19099 28.5 3.3 CE25459_2 28.5 3.4 > CE13720 Length=537 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 33/83 (39%), Gaps = 18/83 (21%) Query 10 ARCA----INPAPPLAPSLP-----------GMRGGSTAQSFRWRLGEEKCGAIHRHAFT 54 A+CA + PP PS P G+ G T ++ RL K G +H + Sbjct 5 AKCASLKRASNLPP--PSFPPEETRDGKWKTGLLGVFTIDAYNERLSIMK-GEVHEDVWK 61 Query 55 WYDRQPPTVLHCHTLRSRPQPAH 77 WYD + C + +++ H Sbjct 62 WYDNKKSMFFECASAKAKLMAGH 84 > Hs6806882 Length=756 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 27 MRGGSTAQSFRWRLGEEKCGAIHRHAF 53 ++GG F R+GE G +H HAF Sbjct 494 LKGGEEGLLFGNRVGERVLGTVHTHAF 520 > Hs4502117 Length=729 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 27 MRGGSTAQSFRWRLGEEKCGAIHRHAF 53 ++GG F R+GE G +H HAF Sbjct 494 LKGGEEGLLFGNRVGERVLGTVHTHAF 520 > Hs14785908 Length=756 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 27 MRGGSTAQSFRWRLGEEKCGAIHRHAF 53 ++GG F R+GE G +H HAF Sbjct 494 LKGGEEGLLFGNRVGERVLGTVHTHAF 520 > 7290075 Length=2221 Score = 28.9 bits (63), Expect = 2.8, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query 67 HTLRSRPQPAHPPFRVARRPVDARSARVFFGPL 99 T+++RP+ HPPF V R + A+ RV + PL Sbjct 1157 QTIQARPK--HPPFNVTVRAMSAQQLRVRWIPL 1187 > CE26240 Length=913 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query 26 GMRGGSTAQSFRWRLGEEKCGAIHRHAFTWYDRQPPTVLHCHTLRSRPQPAH 77 G+ G T ++ RL K G +H + WYD + C + +++ H Sbjct 414 GLLGVFTIDAYNERLSIMK-GKVHEEVWKWYDNKKSMFFECASAKAKLMAGH 464 > CE19099 Length=915 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 0/40 (0%) Query 48 IHRHAFTWYDRQPPTVLHCHTLRSRPQPAHPPFRVARRPV 87 +HRH TW D + L +RP P+ P +VA + Sbjct 708 MHRHPPTWLDENDRELFGTQGLDNRPGPSAQPVQVAVEQI 747 > CE25459_2 Length=888 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query 26 GMRGGSTAQSFRWRLGEEKCGAIHRHAFTWYDRQPPTVLHCHTLRSRPQPAH 77 G+ G T ++ RL K G +H + WYD + C + +++ H Sbjct 405 GLLGVFTIDAYNERLSIMK-GEVHEDVWKWYDNKKSMFFECASAKAKLMAGH 455 Lambda K H 0.327 0.138 0.488 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1195973986 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40