bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8659_orf2 Length=92 Score E Sequences producing significant alignments: (Bits) Value 318161.Sden_3464 32.3 4.5 > 318161.Sden_3464 Length=1018 Score = 32.3 bits (72), Expect = 4.5, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 13 CLSSCCSFCFLSCCCSSCVACCSCYFAVPHPSVRQQIFAQSKKPLISI 60 CL + L C ++CV Y A PS++Q++ AQ + +I + Sbjct 507 CLRQVLRYKVLQMCFAACVLGLGLYTAQLFPSIKQELIAQPEAEIIDV 554 Lambda K H 0.336 0.138 0.543 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40