bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8659_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value 246196.MSMEG_6418 33.5 1.7 9258.ENSOANP00000018852 33.1 2.3 > 246196.MSMEG_6418 Length=310 Score = 33.5 bits (75), Expect = 1.7, Method: Compositional matrix adjust. Identities = 28/77 (36%), Positives = 36/77 (46%), Gaps = 17/77 (22%) Query 10 GHDAPLRTAKAAPTAATASRSSIYGNKGLFGLRENLLAHRRMRDSEVAAAASNAAAA--A 67 GHD P+RT A P AA R + N +RD+EV A SNAAAA Sbjct 104 GHDGPVRTVAAFPVAAAQVRHWLAAN---------------LRDAEVVPAHSNAAAAHDV 148 Query 68 ARQEAEAAAARKAAAAK 84 A A+A + + AA + Sbjct 149 AEGRADAGVSTRLAAER 165 > 9258.ENSOANP00000018852 Length=613 Score = 33.1 bits (74), Expect = 2.3, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 0/53 (0%) Query 39 FGLRENLLAHRRMRDSEVAAAASNAAAAAARQEAEAAAARKAAAAKAATAPLC 91 FG NLL HRR+ E + A A++ AA R K PLC Sbjct 482 FGWSSNLLKHRRVHTGEKPHRCPDCGRAFAQRSQLAAHRRTHTGEKPHRCPLC 534 Lambda K H 0.310 0.115 0.309 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40