bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8606_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000025874 32.0 5.3 > 9258.ENSOANP00000025874 Length=294 Score = 32.0 bits (71), Expect = 5.3, Method: Composition-based stats. Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 7/78 (8%) Query 1 STRERELVSKFFFFFFFATLELNSAFKGLLKIPFFAFSTVCCCCAFRC-------TDSSA 53 +T ER+ V++F F+ L+ + L+ FS V A+RC ++ + Sbjct 60 ATSERDFVAEFLFWASLCMTHLSKVAEDLILYGTKEFSFVQLSDAYRCPLGPEPSSNPGS 119 Query 54 HACCASNCSRLFAKCANL 71 AC S+ ++ +CA L Sbjct 120 AACLLSDFGQVLGRCAGL 137 Lambda K H 0.337 0.139 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23091434817 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40