bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8567_orf4 Length=116 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000002366 32.0 5.1 > 9031.ENSGALP00000002366 Length=735 Score = 32.0 bits (71), Expect = 5.1, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 35 WGAFRRSLCSACRGRSSAAGILCRRIKQQVKPRLLF 70 W F+ + AC +SAA +LC+R+ + PR ++ Sbjct 302 WSCFKDARILACAPSNSAADLLCQRLLTNIAPRYIY 337 Lambda K H 0.319 0.130 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40