bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8567_orf3 Length=107 Score E Sequences producing significant alignments: (Bits) Value 257311.BPP0935 34.7 0.82 257310.BB1144 34.7 0.82 9606.ENSP00000362153 32.0 5.9 9598.ENSPTRP00000000969 32.0 5.9 314565.XC_2198 31.6 7.1 288000.BBta_2543 31.6 7.1 190485.XCC1986 31.6 7.1 > 257311.BPP0935 Length=267 Score = 34.7 bits (78), Expect = 0.82, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 7/70 (10%) Query 9 MHCRVVPPQMTNATGEEVWESAGEGSQKGQKR--FRQIFVGGQVVGEGAYAQGLVHAPVS 66 + R+V P NA +WE+ G+ + Q R R I + G+ GE A+ G A +S Sbjct 20 LRVRIVNPARYNAMSLSMWEALGQAVRDAQGRDDLRAIVLEGE--GERAFVSG---ADIS 74 Query 67 NSIDPRNDPA 76 R DPA Sbjct 75 EFASQRKDPA 84 > 257310.BB1144 Length=267 Score = 34.7 bits (78), Expect = 0.82, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 7/70 (10%) Query 9 MHCRVVPPQMTNATGEEVWESAGEGSQKGQKR--FRQIFVGGQVVGEGAYAQGLVHAPVS 66 + R+V P NA +WE+ G+ + Q R R I + G+ GE A+ G A +S Sbjct 20 LRVRIVNPARYNAMSLSMWEALGQAVRDAQGRDDLRAIVLEGE--GERAFVSG---ADIS 74 Query 67 NSIDPRNDPA 76 R DPA Sbjct 75 EFASQRKDPA 84 > 9606.ENSP00000362153 Length=731 Score = 32.0 bits (71), Expect = 5.9, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 7 PQMHCRVVPPQMTNATGEEVWESAGEGSQ 35 P VVP N GEEV E+AGEGS+ Sbjct 475 PSSSLEVVPEAAQNNPGEEVTETAGEGSE 503 > 9598.ENSPTRP00000000969 Length=731 Score = 32.0 bits (71), Expect = 5.9, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 7 PQMHCRVVPPQMTNATGEEVWESAGEGSQ 35 P VVP N GEEV E+AGEGS+ Sbjct 475 PSSSLEVVPEAAQNNPGEEVTETAGEGSE 503 > 314565.XC_2198 Length=406 Score = 31.6 bits (70), Expect = 7.1, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 22 TGEEVWESAGEGSQKGQKRFRQIFVGGQVVGEGAYAQGLVHAPV 65 TG+ VWE + ++ ++F+Q GG VGEG G + V Sbjct 100 TGKRVWEYKPKKEERNDRKFKQRLSGGPGVGEGLVVIGTLSGDV 143 > 288000.BBta_2543 Length=462 Score = 31.6 bits (70), Expect = 7.1, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Query 25 EVWESAGEGSQKGQKRFRQIFVGGQVVGEGAYAQGLVHAPVSNSIDPRNDP--AAAPARS 82 + W+ G ++G F IF+ + Y Q L HA + P NDP AAP Sbjct 26 DYWQDLGRTLERGI--FDGIFIADVIGYYDVYKQSLFHALEQAAQIPVNDPLQLAAPIAL 83 Query 83 AAAAAAVAAAAAPVYGSPASFA 104 A + A+ + P +FA Sbjct 84 ATEHLGIGITASTSFEHPYTFA 105 > 190485.XCC1986 Length=406 Score = 31.6 bits (70), Expect = 7.1, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 22 TGEEVWESAGEGSQKGQKRFRQIFVGGQVVGEGAYAQGLVHAPV 65 TG+ VWE + ++ ++F+Q GG VGEG G + V Sbjct 100 TGKRVWEYKPKKEERNDRKFKQRLSGGPGVGEGLVVIGTLSGDV 143 Lambda K H 0.316 0.128 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40