bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8567_orf2 Length=132 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000036537 36.2 0.28 6239.H22D14.1 33.9 1.4 6239.F14A5.1 33.1 2.2 > 13616.ENSMODP00000036537 Length=993 Score = 36.2 bits (82), Expect = 0.28, Method: Composition-based stats. Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 17/107 (15%) Query 20 ATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRD-NPAVHLRRIEVLALLAALFFGIVY 78 A ++L +S+LP + LA LPD I L + N ++ + + ++ +LLA FF + Sbjct 596 AEAQHLCQSILPDMVKLALCLPDICTKPIPLLKQKMNHSITMSQEQIASLLANAFF-CTF 654 Query 79 PLQMNA---------PDMHYRGFFE-----RPPKYQSLLQYFQQMQQ 111 P + NA PD+++ FE +P K ++L YF+++ + Sbjct 655 P-RRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRKVTE 700 > 6239.H22D14.1 Length=344 Score = 33.9 bits (76), Expect = 1.4, Method: Compositional matrix adjust. Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query 56 PAVH-LRRIEVLALLAALFFGIVYPLQMNAPDMHYRGFFERPPKYQSLLQYFQQMQQTVG 114 P V+ L + +V LL F V+ + A M +E PK + L +Y QQ++ T+G Sbjct 204 PGVNSLEKEDVQTLLKYFQFANVWMDSVRAYSMSNVDIYETTPKDKRLSEYIQQVKLTLG 263 Query 115 SCWQQM 120 S + Q+ Sbjct 264 SSFSQL 269 > 6239.F14A5.1 Length=408 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query 56 PAVH-LRRIEVLALLAALFFGIVYPLQMNAPDMHYRGFFERPPKYQSLLQYFQQMQQTVG 114 P V+ L + +V LL F V+ + A M +E PK + L +Y QQ++ T+G Sbjct 254 PGVNSLEKEDVQTLLKYFQFANVWMDSVRAYSMSNVDIYETTPKDKRLSEYIQQVKLTLG 313 Query 115 SCWQQM 120 S + Q+ Sbjct 314 SSFSQL 319 Lambda K H 0.328 0.143 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40