bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8249_orf1 Length=62 Score E Sequences producing significant alignments: (Bits) Value 290399.Arth_3421 32.7 2.9 8090.ENSORLP00000009276 32.7 3.1 > 290399.Arth_3421 Length=323 Score = 32.7 bits (73), Expect = 2.9, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query 2 LFVYLTQKKPPKVSFPAAAAAAAAAAAAALAKSPPAPQLSFSFLPGLPAARQQQQQQQGQ 61 L V K+P ++ FPA AA +AA+ AL + PA +L + GLPA R+ + + Sbjct 216 LTVTAATKRPVQLRFPATAAVSAASLVDALDAAIPA-ELYHDDIHGLPAWRKDMTYRLAE 274 Query 62 Q 62 + Sbjct 275 E 275 > 8090.ENSORLP00000009276 Length=875 Score = 32.7 bits (73), Expect = 3.1, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 13 KVSF--PAAAAAAAAAAAAALAKSPPAPQLSFSFLPGLPAARQQQQQQQGQQ 62 K SF PA A+ A + + K+PPA Q SF P + R+ QQ+ + Q+ Sbjct 651 KASFQQPAGASTEDAVDSTSKDKTPPAAQTGTSFNPTRTSWRRHQQRARSQE 702 Lambda K H 0.315 0.123 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22370551947 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40