bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8195_orf4 Length=120 Score E Sequences producing significant alignments: (Bits) Value 243090.RB365 32.3 4.2 > 243090.RB365 Length=545 Score = 32.3 bits (72), Expect = 4.2, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Query 49 GPTSGGPWEGP--QKILKSEHLVFCPAVAAAANSSNPCCSSSSSCCCCALLLCAQHGRLW 106 GP+ P E P I++S+ + P V ++ S+P S S+ C CCA C + + Sbjct 52 GPSPTSPSEAPAASSIVESQSPIAEPVVDSST-YSDPYASYSAPCTCCANGCCTKKKKEA 110 Query 107 GKPSAAGRVFGIF 119 G G+F Sbjct 111 AMAKMKGAYQGVF 123 Lambda K H 0.323 0.130 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40