bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8195_orf2 Length=104 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000006574 31.6 6.6 101510.RHA1_ro06355 31.2 8.8 > 9258.ENSOANP00000006574 Length=1800 Score = 31.6 bits (70), Expect = 6.6, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query 28 SSSHSWAEYQVFAFENLLRAFPGAPGCGASSSSNSCCKTHAAASSSSSRSETLLLLL 84 S SW Y+ FA+ N + FPG P S+ C + SS+ E + +L Sbjct 162 DSGRSWKVYRYFAY-NCSKLFPGVPTAPGIRVSDLVCDQRYSDIEPSSQGEVIFKVL 217 > 101510.RHA1_ro06355 Length=404 Score = 31.2 bits (69), Expect = 8.8, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 0/54 (0%) Query 48 FPGAPGCGASSSSNSCCKTHAAASSSSSRSETLLLLLPLCSECAAAPPICTVAG 101 FPGA G GA + N + + + LL +P+ + AA P + TVAG Sbjct 336 FPGALGPGAVMAGNLLVPVESGIAVLDLSTGALLRTIPVTRDAAAGPILTTVAG 389 Lambda K H 0.315 0.120 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22759408663 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40