bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8195_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 402882.Shew185_2016 32.3 3.8 325240.Sbal_2001 32.3 3.8 > 402882.Shew185_2016 Length=457 Score = 32.3 bits (72), Expect = 3.8, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query 20 RPPSCEPARGAPVQVLLRSDF-LSFYPDNFKVLDDKEYHLTPIIFVFIKLDGGKKYFQLK 78 +PP P G L++ F + DN +L ++EY P++ V L G K++ + Sbjct 39 KPPKAAPIIGLETASELKNRFRIDHMVDNMTLLVEREYGSAPVVIV---LPDGSKWYANR 95 Query 79 IPKTRPAADG 88 P+T DG Sbjct 96 HPETVKWVDG 105 > 325240.Sbal_2001 Length=457 Score = 32.3 bits (72), Expect = 3.8, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query 20 RPPSCEPARGAPVQVLLRSDF-LSFYPDNFKVLDDKEYHLTPIIFVFIKLDGGKKYFQLK 78 +PP P G L++ F + DN +L ++EY P++ V L G K++ + Sbjct 39 KPPKAAPIIGLETASELKNRFRIDHMVDNMTLLVEREYGSAPVVIV---LPDGSKWYANR 95 Query 79 IPKTRPAADG 88 P+T DG Sbjct 96 HPETVKWVDG 105 Lambda K H 0.326 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40