bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8040_orf2 Length=112 Score E Sequences producing significant alignments: (Bits) Value 56780.SYN_01499 37.0 0.16 78245.Xaut_1747 32.3 3.9 347834.RHE_CH01894 32.3 4.1 > 56780.SYN_01499 Length=317 Score = 37.0 bits (84), Expect = 0.16, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Query 9 LPGVATRVASSEIVSTILSALGHWDPSLWLQVGVGSREERRPFQGFTPGDAQEFGNICCK 68 L G+A + I++ L+ +G + P+LWL++ +G+R+E + +GF DA + IC + Sbjct 127 LAGIAVNPLAVMIITLALALVGFYLPNLWLRLKIGARKE-KIMEGFP--DALDLMVICVE 183 Query 69 PTFG 72 G Sbjct 184 AGMG 187 > 78245.Xaut_1747 Length=467 Score = 32.3 bits (72), Expect = 3.9, Method: Compositional matrix adjust. Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 15/74 (20%) Query 1 IPWL-----LLP--SLPGVATRVASSEIVSTILSALGH----WDPSLWLQVGVGSREE-- 47 +PW+ L+P +LPG R+A +E+V+ +L+A G+ D + R Sbjct 252 VPWMKKHQALIPEDALPGAGARLAQAELVADVLAAHGYVPVGLDHFARASDAMAERAAAG 311 Query 48 --RRPFQGFTPGDA 59 +R FQG+T DA Sbjct 312 TLKRNFQGYTTDDA 325 > 347834.RHE_CH01894 Length=120 Score = 32.3 bits (72), Expect = 4.1, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 71 FGAHRPFDVEQLFLMLLAEAASTE 94 FG HRPF+V+ L+L +LA + S E Sbjct 76 FGGHRPFEVDNLYLHMLAISKSFE 99 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40