bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_8008_orf2 Length=62 Score E Sequences producing significant alignments: (Bits) Value 331272.Bcen2424_0914 32.0 4.8 331271.Bcen_0435 32.0 4.8 9371.ENSETEP00000007053 32.0 4.9 351746.Pput_5022 32.0 5.6 5807.cgd2_1590 32.0 5.8 13616.ENSMODP00000006121 32.0 5.9 > 331272.Bcen2424_0914 Length=463 Score = 32.0 bits (71), Expect = 4.8, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query 8 LSLSLSLLGCARCTRAAIAFGGKELQTVSGLPHETVCQFA 47 LS++ LLG AR T F + + GLPH+TV FA Sbjct 195 LSMTADLLGAARAT----GFHSVSVDLIYGLPHQTVAVFA 230 > 331271.Bcen_0435 Length=463 Score = 32.0 bits (71), Expect = 4.8, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query 8 LSLSLSLLGCARCTRAAIAFGGKELQTVSGLPHETVCQFA 47 LS++ LLG AR T F + + GLPH+TV FA Sbjct 195 LSMTADLLGAARAT----GFHSVSVDLIYGLPHQTVAVFA 230 > 9371.ENSETEP00000007053 Length=631 Score = 32.0 bits (71), Expect = 4.9, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query 17 CARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 C AA+ FGG+EL V+ + VCQ C +C+FFT+ Sbjct 286 CHSNIYAAVDFGGEELN-VTFVKDVNVCQETCTKMARCQFFTY 327 > 351746.Pput_5022 Length=467 Score = 32.0 bits (71), Expect = 5.6, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Query 1 DLSLSLSLSLSLSLLGCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFD 60 DL+L+L + +G A T AI F G ++ ++ T+C A E +C FD Sbjct 183 DLALAL-----IGRIGTAGATGYAIEFAGSTVERMTMEARMTLCNLAIEAGARCAMVAFD 237 > 5807.cgd2_1590 Length=614 Score = 32.0 bits (71), Expect = 5.8, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 20 CTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV 62 C + I + G +Q + L CQ C+++ C FFT+D + Sbjct 359 CYDSDIEYPGYTIQILHSLTSAFDCQLQCQVDLGCDFFTYDMM 401 > 13616.ENSMODP00000006121 Length=633 Score = 32.0 bits (71), Expect = 5.9, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query 12 LSLLGCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 LS +GC+ ++F G+ + +V P +VC+ C + C FFTF Sbjct 204 LSNMGCSTTIFQHLSFSGENVGSVIA-PDRSVCRTICTYHPNCLFFTF 250 Lambda K H 0.326 0.136 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22370551947 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40