bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7958_orf2 Length=123 Score E Sequences producing significant alignments: (Bits) Value 331272.Bcen2424_2939 33.1 2.7 8090.ENSORLP00000018135 32.0 4.9 243275.TDE0204 32.0 5.7 > 331272.Bcen2424_2939 Length=555 Score = 33.1 bits (74), Expect = 2.7, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query 48 AAAAADNAAVADDDVAAALAVAAASGPPLKAQEQQGVAYGLQLRCSAAAASGSS----RS 103 AA AD +A D LA A GP +AQ QQ LQ+R +A A S+ RS Sbjct 465 AARCADISARVMDQYRRRLAALADDGPTPRAQAQQAETMELQMRIAAVRAERSALYRLRS 524 Query 104 TSSSSNSS 111 S S+ + Sbjct 525 DSKISDET 532 > 8090.ENSORLP00000018135 Length=3038 Score = 32.0 bits (71), Expect = 4.9, Method: Composition-based stats. Identities = 30/116 (25%), Positives = 43/116 (37%), Gaps = 14/116 (12%) Query 15 SPVLEGLSHPLWRCR---------ALISTGFCCYCCCAAAGNAAAAADNAAVADDDVAAA 65 SPVL S PL +C AL S G CA A + AV+ +A+ Sbjct 2336 SPVLPVGSGPLGKCSVQTSEDKAIALPSAGTTTSTLCAMASTPTSKLWQGAVSPHPIASP 2395 Query 66 LAVAAASG-----PPLKAQEQQGVAYGLQLRCSAAAASGSSRSTSSSSNSSSSCGG 116 L +A PP ++ G + + S A+ G+ + S CGG Sbjct 2396 LVTSAFGTEAFPPPPSSPCQKFGPGFWSSIPGSPASRPGAFTFSEDGGEVQSGCGG 2451 > 243275.TDE0204 Length=506 Score = 32.0 bits (71), Expect = 5.7, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query 4 EGGPPGGPLEGSPVLEGLSHPLWR--CRALISTGFCCYCCC 42 EGGP GGP +P ++ ++R + L+ GF YC C Sbjct 70 EGGPKGGPC--APYIQSQRFDIYRKYAQELVDKGFAYYCFC 108 Lambda K H 0.312 0.126 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40