bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7958_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000013681 32.3 3.9 > 13616.ENSMODP00000013681 Length=191 Score = 32.3 bits (72), Expect = 3.9, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Query 37 AIGNPLLLLGFQWGPRSSSNGKCSS-NIIISNSSIISSSSSITSSSTAAVAAEASA 91 IG PLL F W NG CS+ N+++ +++ + + T AVA +A A Sbjct 69 VIGLPLLAFDFHW-----VNGDCSTANLLLGAGMVLAIAGDFLDTETQAVAGQAVA 119 Lambda K H 0.307 0.119 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40