bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7773_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 203119.Cthe_2390 32.7 2.9 3702.AT3G19240.1 31.6 6.6 > 203119.Cthe_2390 Length=192 Score = 32.7 bits (73), Expect = 2.9, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 20 SSQMQVETLADQAPTNPFSGGTYAFKKLTDEQHSCKETVDYWKAAFKN 67 + ++ +ETL P P G K+ DE+ K+ V+ +K F N Sbjct 123 ARKISIETLGKYFPNTPMLGAVVKVSKIMDEEEFLKDMVESFKHKFAN 170 > 3702.AT3G19240.1 Length=648 Score = 31.6 bits (70), Expect = 6.6, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Query 20 SSQMQVETLADQAPTNPFSGGTYAFKKLTDEQHSCKETVDYWKAAFKNFTGLPPSKNDAG 79 S+ MQ++ DQ + S G +A K LTDE + K + F+N + S+ + Sbjct 156 STDMQLKMFGDQRRVDFVSNGVWALKFLTDEDYR-KFVTRFQDYLFENVYKIRASEENRV 214 Query 80 ELYNSQDNVSFVALYNPSA 98 ++Y F+ NP A Sbjct 215 KVYGK----DFIGWANPEA 229 Lambda K H 0.314 0.128 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40