bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7659_orf3 Length=193 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL009110-PA 33.5 3.6 369723.Strop_3718 32.7 5.7 > 7159.AAEL009110-PA Length=1421 Score = 33.5 bits (75), Expect = 3.6, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 0/75 (0%) Query 46 GCHLTRLSVWAEDVPSNWLDTVPSDRHAGRPEGLAGSKTSAETALLVSFLHRHALTWGGA 105 GC LT L + P VPSD+ GR + G + S ++++ + H+ + A Sbjct 768 GCDLTELDENWDSQPKTSPSIVPSDKRKGRVQTPVGEQNSHRKNVVLNSIATHSQMFRSA 827 Query 106 AATPQENLRQAPAGA 120 +A N R A A Sbjct 828 SAEEMRNSRNLMALA 842 > 369723.Strop_3718 Length=433 Score = 32.7 bits (73), Expect = 5.7, Method: Compositional matrix adjust. Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Query 102 WGGAAATPQENLRQAPAGAIRRVSSASMLRAVGLQHLRGLSCPSCLLAELSAASSVLPAL 161 W G + P E LR G ++ + L GL +RG L A+LS S + PAL Sbjct 270 WPGGSVQPVERLR----GLLQAMGGEVSLSTTGLT-VRGTGSVHGLTADLSDVSELTPAL 324 Query 162 KNLDTWGDSRRLTTFLQQKRQLETVRVRGL 191 L DS T + R ET R+ L Sbjct 325 TALAMLADSPSRFTGIAHIRGHETDRISAL 354 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44278360200 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40