bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7659_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00035396001 32.7 3.0 > 99883.GSTENP00035396001 Length=185 Score = 32.7 bits (73), Expect = 3.0, Method: Compositional matrix adjust. Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 15/100 (15%) Query 2 GSSGIIFAQT-RPHVGWGGGYATGKPQAGSRRGNSACLISFHAAGCRAAAPPGPQLPQLP 60 GSSG + + R + G + T + + G+ C + PP PQ Q Sbjct 87 GSSGTLLPDSLREDCWYNGPWPTHRCPGDALGGSDTCSVFL---------PPPPQ-NQAS 136 Query 61 LGRAQRSFQRPPRPQEPRHLGRQSEAHNVSPAEETVGDCT 100 L + RSF PP+P + E H +P+ ++G+CT Sbjct 137 LDDSSRSFPSPPKPSDAMFW----EGHFTTPSSSSIGNCT 172 Lambda K H 0.317 0.134 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40