bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7659_orf1 Length=194 Score E Sequences producing significant alignments: (Bits) Value 383372.Rcas_0124 34.3 2.0 357808.RoseRS_4577 34.3 2.4 326298.Tmden_0668 33.5 4.1 > 383372.Rcas_0124 Length=769 Score = 34.3 bits (77), Expect = 2.0, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Query 146 RWHPYSLRNSNSSNHSPLLHTLTSSCRRQGAEMNARN 182 RW PY +RN S HSPL L R GA M+ N Sbjct 591 RWAPYYIRNVRVSVHSPLFKVL----RDAGAPMDPEN 623 > 357808.RoseRS_4577 Length=768 Score = 34.3 bits (77), Expect = 2.4, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 28/68 (41%), Gaps = 16/68 (23%) Query 115 AKPSGRPAWRSEGTVSSQLEGTSSAQTLSRVRWHPYSLRNSNSSNHSPLLHTLTSSCRRQ 174 KPSG SSQL SS RW PY +RN S HSPL L R Sbjct 572 VKPSGN---------SSQLLDCSSGL---HARWAPYYIRNVRVSAHSPLFKVL----RDA 615 Query 175 GAEMNARN 182 G M+ N Sbjct 616 GVPMDPEN 623 > 326298.Tmden_0668 Length=271 Score = 33.5 bits (75), Expect = 4.1, Method: Compositional matrix adjust. Identities = 27/106 (25%), Positives = 41/106 (38%), Gaps = 3/106 (2%) Query 85 CGVAAAPPHVRACLCKNDTRRAVSAEVLEPAKPSGRPAWRSEGTVSSQLEGTSSAQTLSR 144 C V A + R KND+ V +VL + R E T + L SS TL++ Sbjct 47 CNVLAKLENFRVVWNKNDSESFVKGDVLATLSATSHVLLRVERTFLNMLLHASSIATLTK 106 Query 145 VR---WHPYSLRNSNSSNHSPLLHTLTSSCRRQGAEMNARNVMSSS 187 PY ++ ++ P+L R G +N R + S Sbjct 107 KYADIIEPYGVKLLDTRKTRPMLRVFEKYATRCGGAVNHRMGLDDS 152 Lambda K H 0.316 0.123 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44893337425 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40