bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7625_orf2 Length=69 Score E Sequences producing significant alignments: (Bits) Value 261594.GBAA1436 32.3 3.9 260799.BAS1327 32.3 3.9 198094.BA1436 32.3 3.9 > 261594.GBAA1436 Length=628 Score = 32.3 bits (72), Expect = 3.9, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query 2 IRLFLLLIFPAQFADKLPLPQGQQHRQFLSIRSSLLLASLCGVLVPPGLFYSSL 55 I +FL FPA F DK PL + ++ F S+ + L L + V+ P +F S Sbjct 130 ILMFLSRKFPA-FCDKTPLSRSEKRTFFSSVTALLALQIVVSVIYKPQMFSRSF 182 > 260799.BAS1327 Length=628 Score = 32.3 bits (72), Expect = 3.9, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query 2 IRLFLLLIFPAQFADKLPLPQGQQHRQFLSIRSSLLLASLCGVLVPPGLFYSSL 55 I +FL FPA F DK PL + ++ F S+ + L L + V+ P +F S Sbjct 130 ILMFLSRKFPA-FCDKTPLSRSEKRTFFSSVTALLALQIVVSVIYKPQMFSRSF 182 > 198094.BA1436 Length=628 Score = 32.3 bits (72), Expect = 3.9, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query 2 IRLFLLLIFPAQFADKLPLPQGQQHRQFLSIRSSLLLASLCGVLVPPGLFYSSL 55 I +FL FPA F DK PL + ++ F S+ + L L + V+ P +F S Sbjct 130 ILMFLSRKFPA-FCDKTPLSRSEKRTFFSSVTALLALQIVVSVIYKPQMFSRSF 182 Lambda K H 0.334 0.149 0.463 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22781900540 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40