bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7516_orf3 Length=86 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000031629 32.7 3.0 9598.ENSPTRP00000055126 32.0 5.8 > 7955.ENSDARP00000031629 Length=959 Score = 32.7 bits (73), Expect = 3.0, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Query 15 KRESGGCNPNASLHSLRNLPKCSSCSR--RPVGARKTLSCDSSPTAEGLRF 63 K ES G P A S+ LP+ SS ++ P G +KT SCDS T LR Sbjct 811 KPESWGNVPKA--ESMETLPERSSSAKTSEPSGLKKTDSCDSGITKSDLRL 859 > 9598.ENSPTRP00000055126 Length=463 Score = 32.0 bits (71), Expect = 5.8, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 30/75 (40%), Gaps = 5/75 (6%) Query 12 GGTKRESGGCNPNASLHSLRNLPKCSSCSRRP-----VGARKTLSCDSSPTAEGLRFTTI 66 GG E GG P+ S SL +P S S +P G TL C S T Sbjct 296 GGVSSEQGGAAPHPSFFSLGQIPDRPSLSVQPGPTVASGENVTLLCQSWQQFHTFLLTKA 355 Query 67 YLRDSHSDIRSTNES 81 D+ +RST +S Sbjct 356 GAADAPLHLRSTQKS 370 Lambda K H 0.314 0.126 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22443299781 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40