bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7516_orf2 Length=76 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000018475 32.0 5.6 > 10116.ENSRNOP00000018475 Length=1466 Score = 32.0 bits (71), Expect = 5.6, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query 28 GAAIQTLPCTLSEICPSAALAVDGQSVRGKHCLATLRQPRKAFASP 73 G A+ T PC L C +++L V GQ G+H + LR ++ A+P Sbjct 1216 GTALGTEPC-LGGHCLNSSLLVTGQPSSGRHPVLDLRGHKRKLATP 1260 Lambda K H 0.324 0.134 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23163449821 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40