bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7516_orf1 Length=86 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000011931 32.3 4.7 99883.GSTENP00022870001 32.0 5.5 31033.SINFRUP00000153654 31.6 7.1 > 9031.ENSGALP00000011931 Length=2079 Score = 32.3 bits (72), Expect = 4.7, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 0/58 (0%) Query 29 AVGEESQDSVFLAPTGRLLQELHLGRFRRECKEAFGLQPPDSRLVPPDRDESDALSHF 86 AVG S F + ++ +F REC E +G P D V R+ +A SHF Sbjct 1680 AVGVSSLPKTFTRLIKIQEENYNVDQFLRECTECYGYNPRDVAAVLEIRNAIEAASHF 1737 > 99883.GSTENP00022870001 Length=330 Score = 32.0 bits (71), Expect = 5.5, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 9/54 (16%) Query 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRF 55 P LD+ L++ ES+ ++ +E +DS+FL GRL Q L LGR+ Sbjct 239 PSPLDAGGALVAGWESIMHL---------NQEEKDSLFLLVLGRLCQSLVLGRY 283 > 31033.SINFRUP00000153654 Length=340 Score = 31.6 bits (70), Expect = 7.1, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 9/54 (16%) Query 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRF 55 P LD+ L++ ES+ ++ +E +DS+FL GRL Q L LGR+ Sbjct 258 PSPLDAGGALVAGWESIMHL---------NQEEKDSLFLLVLGRLCQSLVLGRY 302 Lambda K H 0.319 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22443299781 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40