bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7287_orf3 Length=84 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000006596 33.1 2.2 184922.7968 31.6 6.5 > 10116.ENSRNOP00000006596 Length=555 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%) Query 18 ETTKGLLYKIFYLLLCTNPNPAS----SKSSSRRLKKQQRRASNDLKLSSASSLC---LR 70 + T L Y IF++L C P A + + + LK+ QR AS + K A +L LR Sbjct 262 QLTSALPYFIFFILFCWVPESARWLMITGKTDQALKELQRIASINGKKDIAQNLTTEDLR 321 Query 71 SRWGGDVCGGVR 82 S+ DVC V+ Sbjct 322 SKVKEDVCSTVK 333 > 184922.7968 Length=321 Score = 31.6 bits (70), Expect = 6.5, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 22 GLLYKIFYLLLCTNPNPASSKSSSRR 47 G L K++Y+ LCTN +P +S+SS R Sbjct 250 GCLMKVYYVSLCTNLDPMTSESSQTR 275 Lambda K H 0.324 0.133 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22587329789 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40