bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7230_orf1 Length=76 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000147260 32.0 5.0 8364.ENSXETP00000056332 31.6 7.8 > 31033.SINFRUP00000147260 Length=186 Score = 32.0 bits (71), Expect = 5.0, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query 23 TAAATLLNVLLQQMRFAAAARTLGAPSTLGG-PPSLGGSPSWGPP 66 T AA LL+ L++ M R G P L PP GGS +WG P Sbjct 94 TFAAELLHHLMESMPLNDQERQRGIPDALSTRPPCGGGSAAWGSP 138 > 8364.ENSXETP00000056332 Length=517 Score = 31.6 bits (70), Expect = 7.8, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 46 GAPSTLGGPPSLGGSPSWGPPRVLG 70 G PS L GPPS GG+ S G P G Sbjct 438 GGPSALAGPPSTGGALSSGGPSARG 462 Lambda K H 0.313 0.125 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23163449821 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40