bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7219_orf6 Length=96 Score E Sequences producing significant alignments: (Bits) Value 326297.Sama_1418 32.0 4.9 5207.CNG02730 31.6 7.1 > 326297.Sama_1418 Length=447 Score = 32.0 bits (71), Expect = 4.9, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 15 VGSCRCWCTLLRSQCSYFIAAATPPQQQLGFSGSSRAT 52 V S R +CT +R F+A +PP + L FS S+ AT Sbjct 317 VPSLREYCTEVRLMAEAFLAQLSPPNRSLSFSDSAIAT 354 > 5207.CNG02730 Length=494 Score = 31.6 bits (70), Expect = 7.1, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 0/60 (0%) Query 37 TPPQQQLGFSGSSRATATPLHIFYLPALPRDYRKSEVLLLLLALQQQQQPQQQQQSAPGV 96 T P GF S RA+ +H LPA+P ++R+ + L +A ++ Q Q GV Sbjct 117 TAPSSPAGFHPSRRASHAKIHFAPLPAVPPEFRRRNSISLGVASRRNLIGMQGQGHKGGV 176 Lambda K H 0.323 0.132 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22546722150 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40