bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7219_orf5 Length=86 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000000209 35.4 0.43 9986.ENSOCUP00000000933 34.7 0.74 59463.ENSMLUP00000001842 34.7 0.93 > 13616.ENSMODP00000000209 Length=952 Score = 35.4 bits (80), Expect = 0.43, Method: Composition-based stats. Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Query 4 RRGARRGPGESGAARG--AGGGSVPARPRGKLRDPRAAGAPRGPQRP 48 R GA++ SG +G AGGG PA+P GK+ DPR G P P+ P Sbjct 256 RNGAKQHLPNSGNGKGFKAGGGPPPAQPAGKVMDPR--GPP--PEYP 298 > 9986.ENSOCUP00000000933 Length=949 Score = 34.7 bits (78), Expect = 0.74, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 6/47 (12%) Query 4 RRGARRGPGESGAARG--AGGGSVPARPRGKLRDPRAAGAPRGPQRP 48 R GA++ SG+A+G AGGG PA P GK+ DPR G P P+ P Sbjct 274 RNGAKQHLPGSGSAKGFKAGGGPSPAPPAGKVLDPR--GPP--PEYP 316 > 59463.ENSMLUP00000001842 Length=958 Score = 34.7 bits (78), Expect = 0.93, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Query 4 RRGARRGPGESGAARG--AGGGSVPARPRGKLRDPRAAGAPRGPQRP 48 R G ++ SG+ +G AGGG PA+P GK+ DPR P P +P Sbjct 272 RNGVKQHLPGSGSGKGFKAGGGPAPAQPAGKVLDPRGP-PPEYPFKP 317 Lambda K H 0.320 0.144 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22443299781 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40