bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7219_orf3 Length=76 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00029317001 36.6 0.24 8090.ENSORLP00000021627 35.0 0.64 59463.ENSMLUP00000006221 34.3 1.2 9031.ENSGALP00000006240 34.3 1.2 8090.ENSORLP00000013829 32.7 3.6 288681.BCZK1338 31.6 7.4 7955.ENSDARP00000006409 31.6 7.6 > 99883.GSTENP00029317001 Length=564 Score = 36.6 bits (83), Expect = 0.24, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Query 12 PGKAGQRAGREAAPFRRGPGESCAIRAPQGPPGAPRGPRGAEGPLEGHF 60 PG+ G R+G+E P P E AP GPPGA + ++ LE H+ Sbjct 355 PGEGGSRSGKEKRPLPPKPAE-----APDGPPGASPNRKRSKAELEDHY 398 > 8090.ENSORLP00000021627 Length=3066 Score = 35.0 bits (79), Expect = 0.64, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 14/55 (25%) Query 10 AVPGKAGQRAGREAAPFRRG-PGESCAIRAPQGPPGA--------PRGPRGAEGP 55 ++PG+AG R G + P G PG+ + PQGPPGA RGP G EGP Sbjct 2804 SIPGEAG-RPGPKGDPGDSGMPGQ----KGPQGPPGAVGPVGAPGVRGPPGKEGP 2853 > 59463.ENSMLUP00000006221 Length=3141 Score = 34.3 bits (77), Expect = 1.2, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Query 7 ARAAVPGKAGQRAGREAAPFRRGPGESCAIRAPQGPPGAP--RGPRGAEGP 55 R VPG+ G G++ RRGP + R G PG+ +G RGA+GP Sbjct 2176 GRDGVPGRPGD-PGKDGGYGRRGPAGAKGNRGGPGQPGSAGEQGTRGAQGP 2225 > 9031.ENSGALP00000006240 Length=3137 Score = 34.3 bits (77), Expect = 1.2, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 29/70 (41%), Gaps = 27/70 (38%) Query 12 PGKAGQRA-----GREAAPFRRGP----------------GESCAIRAPQGPPG-----A 45 PG AGQR GR+ RRGP GE +R PQGPPG Sbjct 2187 PGPAGQRGQDGGVGRKGMAGRRGPIGVKGTKGALGQPGPAGEQ-GMRGPQGPPGQIGTPG 2245 Query 46 PRGPRGAEGP 55 RG +G GP Sbjct 2246 IRGEQGIPGP 2255 > 8090.ENSORLP00000013829 Length=731 Score = 32.7 bits (73), Expect = 3.6, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query 6 AARAAVPGKAGQRA-----GREAAPFRRGPGESCAIRAPQGPPGAPRGPRGAEGPL 56 RA PG G+ GR+ P GP IR P GPPG +GPRG GP+ Sbjct 497 GGRAGPPGTKGEPGSAGLPGRDGLPGPIGPQGPPGIRGPTGPPGE-QGPRGLPGPV 551 > 288681.BCZK1338 Length=436 Score = 31.6 bits (70), Expect = 7.4, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 5/33 (15%) Query 28 RGPGESCAIRAPQGPPGA-----PRGPRGAEGP 55 +GP + PQGP GA P+GP+GA+GP Sbjct 176 QGPAGATGATGPQGPAGAQGATGPQGPQGAQGP 208 > 7955.ENSDARP00000006409 Length=602 Score = 31.6 bits (70), Expect = 7.6, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query 12 PGKAGQRA--GREAAPFRRGPGESCAIRAPQGPPGAPRGPRGAEGP 55 PG+ G + G P +RGP + P GP GA RGP G+EGP Sbjct 357 PGRPGPKGDPGDSGLPGQRGPVGAAGPLGPVGPAGA-RGPPGSEGP 401 Lambda K H 0.318 0.137 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23163449821 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40