bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_7021_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 415426.Hbut_1057 34.7 0.82 9606.ENSP00000294905 32.0 5.9 9598.ENSPTRP00000021476 31.6 6.3 44689.DDBDRAFT_0206011 31.2 9.7 > 415426.Hbut_1057 Length=426 Score = 34.7 bits (78), Expect = 0.82, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 4 HAHGPEEMRGVAVTQVGSHKKELTSPVTVASSSASASCGLGRLAEL 49 HA+ PEE++ VAV G ++L+ P + + S LGRL ++ Sbjct 93 HAYPPEELKPVAVIDAGKLMEKLSPPAELIVVEGNESRSLGRLGKM 138 > 9606.ENSP00000294905 Length=1972 Score = 32.0 bits (71), Expect = 5.9, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 0/52 (0%) Query 55 SSRSSLGSSSGNSNSSGNSTCTSSPAPCHSPFSIPGTAGAPAAVPAADGIAK 106 SS SLGS G S +GNS TS+ A S +P A +A PAA +AK Sbjct 1453 SSVPSLGSGLGLSEGNGNSFLTSNVASSKSESPVPQNEKATSAQPAAVEVAK 1504 > 9598.ENSPTRP00000021476 Length=1970 Score = 31.6 bits (70), Expect = 6.3, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 0/52 (0%) Query 55 SSRSSLGSSSGNSNSSGNSTCTSSPAPCHSPFSIPGTAGAPAAVPAADGIAK 106 SS SLGS G S +GNS TS+ A S +P A +A PAA +AK Sbjct 1452 SSVPSLGSGLGLSEGNGNSFLTSNVASSKSESPVPQNEKATSAQPAAVEVAK 1503 > 44689.DDBDRAFT_0206011 Length=855 Score = 31.2 bits (69), Expect = 9.7, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Query 26 LTSPVTVASSSASASCGLGRLAEL--AEGEVSSRS---SLGSSSGNSNSSGNSTCTS 77 LT+ +T+ + +S S LG L L EGEVS+ L S G SN S N T TS Sbjct 592 LTTFMTITAKKSSGSAILGYLTALLITEGEVSNLDQIMQLASDGGTSNHSTNRTTTS 648 Lambda K H 0.304 0.119 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40