bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6634_orf4 Length=107 Score E Sequences producing significant alignments: (Bits) Value 269799.Gmet_2433 34.7 0.92 243231.GSU2480 33.1 2.6 10116.ENSRNOP00000006319 32.0 4.8 > 269799.Gmet_2433 Length=586 Score = 34.7 bits (78), Expect = 0.92, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Query 31 FAPVVAAASW-----HRRRVSPVLLSLPLDKAPFPAWLLALRLLLALL 73 FAP VA + ++ V P L +LP DK PF WL+ + L++ L Sbjct 518 FAPAVAVLAMAGSLAEKKYVPPSLGTLPTDKVPFALWLMLVILIVGAL 565 > 243231.GSU2480 Length=592 Score = 33.1 bits (74), Expect = 2.6, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Query 31 FAPVVAAASW-----HRRRVSPVLLSLPLDKAPFPAWLLALRLLLALL 73 FAP VA + ++ V P L +LP DK PF WL + L++ L Sbjct 526 FAPAVAVLAMAGSLAEKKYVPPSLGTLPTDKVPFALWLTLVILIVGAL 573 > 10116.ENSRNOP00000006319 Length=930 Score = 32.0 bits (71), Expect = 4.8, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Query 1 SGRSREYRQHKVQQNVAGTGVEDRGSKSFAFAPVVAAASWHRRRVSPVLLSLPLDK 56 S R E R KV++NV V+ +G F A + WHR V + ++LP+ K Sbjct 86 SFRKAENRVLKVEENV--DQVQRKGKMQFLLGRGKAVSLWHRTHVQTLPVTLPMQK 139 Lambda K H 0.324 0.134 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40