bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6634_orf3 Length=105 Score E Sequences producing significant alignments: (Bits) Value 184922.114230 36.2 0.27 5671.LinJ11.1150 33.1 2.7 9685.ENSFCAP00000009260 32.7 3.2 4932.YMR172W 32.3 3.7 10116.ENSRNOP00000010636 31.6 7.7 > 184922.114230 Length=605 Score = 36.2 bits (82), Expect = 0.27, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 12/66 (18%) Query 28 CSGAATEPEATSEPAATQEMAL------YPGAATA-TRGRPCVGARRQQQQREQRQNFCC 80 C+ AA +PE +PA +Q +AL PGAA + GR R +Q +QR FCC Sbjct 292 CNPAA-QPEHPVDPADSQTLALRLSPERQPGAADPPSPGRD----ERVEQSTKQRVKFCC 346 Query 81 PCPQRQ 86 P R Sbjct 347 PRKPRH 352 > 5671.LinJ11.1150 Length=756 Score = 33.1 bits (74), Expect = 2.7, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query 22 SKLDNSCSGAATEPEATSEPAATQEMALYPGAATATRGRPCVGARRQQQQRE---QRQ 76 S L S A T+ E+TS+PA+ PGA R + RR+ ++E QRQ Sbjct 249 SPLQEKESAAVTQAESTSKPASAAPAKEAPGATAKDRAKATPEERREAVKKEIARQRQ 306 > 9685.ENSFCAP00000009260 Length=622 Score = 32.7 bits (73), Expect = 3.2, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 0/39 (0%) Query 28 CSGAATEPEATSEPAATQEMALYPGAATATRGRPCVGAR 66 SG TEP TSEPA T ++A+ R R GAR Sbjct 3 LSGTVTEPATTSEPAVTYKVAISFDVREMLRMRDSNGAR 41 > 4932.YMR172W Length=719 Score = 32.3 bits (72), Expect = 3.7, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 13/68 (19%) Query 9 RHASICRRRGSLHSKLDNSCSG-------AATEPEATSE------PAATQEMALYPGAAT 55 ++ASI +RR SLH K NS +G +AT+P S+ A T ++ T Sbjct 576 KNASINKRRRSLHHKKSNSLNGRRKLHGESATKPNINSDLHYRILKAPTDVKTIWEEYDT 635 Query 56 ATRGRPCV 63 RG+P + Sbjct 636 GIRGKPSI 643 > 10116.ENSRNOP00000010636 Length=661 Score = 31.6 bits (70), Expect = 7.7, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query 4 PADGTRHASICRRRGSLHSKLDNSCSGAATEPEATSEPAATQEMALYPGAAT 55 PA GT H+ CRR+G L K + S AT+P T T E PG + Sbjct 509 PARGTSHSLSCRRKGIL--KHSSRYSDGATDPALTGPEIPTLESLSPPGVPS 558 Lambda K H 0.324 0.131 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40