bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6634_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G08580.1 34.7 0.90 3702.AT5G17900.1 33.9 1.3 8364.ENSXETP00000055883 33.5 1.8 323261.Noc_1699 32.0 6.0 3702.AT5G54730.1 31.2 9.1 > 3702.AT4G08580.1 Length=435 Score = 34.7 bits (78), Expect = 0.90, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Query 27 QEQQQSQKQPQSQQPRRKWRFIQGQRQQHGG-----DPASVPGGSSNNGSKGKTFAAP 79 ++ ++ +P S QP++KW F+ Q+ H G DP G + +G + F+AP Sbjct 302 RDWERKNPKPSSAQPKKKWNFM--QKYYHKGAFFQADPDDEAGSAGTDGIFQRDFSAP 357 > 3702.AT5G17900.1 Length=435 Score = 33.9 bits (76), Expect = 1.3, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Query 27 QEQQQSQKQPQSQQPRRKWRFIQGQRQQHGG-----DPASVPGGSSNNGSKGKTFAAP 79 ++ ++ +P S QP++KW F+ Q+ H G DP G + +G + F+AP Sbjct 302 RDWERKNPKPLSAQPKKKWNFM--QKYYHKGAFFQADPDDEAGSAGTDGIFQRDFSAP 357 > 8364.ENSXETP00000055883 Length=1788 Score = 33.5 bits (75), Expect = 1.8, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 9/53 (16%) Query 30 QQSQKQPQSQQPRRKWRFIQGQRQQHGGD---------PASVPGGSSNNGSKG 73 +S KQP+ Q+P+R++R G ++ GGD + +PG SSN G G Sbjct 1610 DKSSKQPKLQEPQRQYRQANGGTKKAGGDVKASAPSLSVSKIPGLSSNTGKSG 1662 > 323261.Noc_1699 Length=261 Score = 32.0 bits (71), Expect = 6.0, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query 10 PSAAAGAACTASWTTHAQEQQQSQKQPQSQQ 40 PSA AGA TA W TH + + ++Q QP + Q Sbjct 222 PSAVAGA--TALWVTHLKSRHETQAQPSAFQ 250 > 3702.AT5G54730.1 Length=763 Score = 31.2 bits (69), Expect = 9.1, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query 19 TASWTTHAQEQQQSQKQPQSQQPRRKWRFIQGQRQQHGGDPAS-VPGGSSNNGSKGKTFA 77 TA+ T E + + P R+W IQ Q ++ DP S + GG ++ SK K F Sbjct 535 TAAMTGFDSESGLETEGKLAVDPIRRWSMIQNQSRRETHDPHSDIYGGGTSVDSKSKVFP 594 Query 78 APV 80 V Sbjct 595 EVV 597 Lambda K H 0.313 0.124 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40