bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6626_orf3 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5270.UM02567.1 34.3 1.8 > 5270.UM02567.1 Length=448 Score = 34.3 bits (77), Expect = 1.8, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Query 12 KNYTAYMKCEIYKFTKDKEEWQKRQEKRSKTRELFKDIISDAAIEVNNQEAADLLPDNPK 71 K Y +K IY+ KD ++Q++RSK +E F+ ++ + ++ + DLL D P Sbjct 353 KQYRLQVKARIYRQNKDILMQLEKQQQRSKLQETFEGVVEEYG-DMVGVDVEDLLDDGPS 411 Query 72 GKKA--EAESTPLQNEGKGFRKPKNEN 96 G A A+ Q +G+G R N N Sbjct 412 GTGALYGADEEEDQEQGQGDRHYSNGN 438 Lambda K H 0.301 0.123 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40