bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6626_orf2 Length=154 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G41820.1 37.0 0.18 9598.ENSPTRP00000029521 32.7 2.9 > 3702.AT1G41820.1 Length=401 Score = 37.0 bits (84), Expect = 0.18, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query 58 SFSAFPLVFISSSSSPLIVPFLFLFSFFGFRNPFPSFCSGVDSASAFLPFGLSGKRSAAS 117 +F+ FPLVF+ + P+ L + +GF NPF + S D A+ S A + Sbjct 248 TFNVFPLVFVKDNEKPVKDAILNIRKSYGFPNPF-DYGSKEDMDQAWSEMKASKASEART 306 Query 118 WLF 120 LF Sbjct 307 HLF 309 > 9598.ENSPTRP00000029521 Length=291 Score = 32.7 bits (73), Expect = 2.9, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query 76 VPFLFLFSFFGFRNPFPSFCSGVDSASAFLPFGLSGKRSAASWLFTSMAASEIISLNNSL 135 +P++FL + P C+G + +L G++GK S +SW T + A+ + L N Sbjct 197 IPYVFLSEWI-----TPEACTGPSPCAVWLAGGMAGKGS-SSWSHTPVQATAVGQLGNCR 250 Query 136 VLL 138 LL Sbjct 251 ALL 253 Lambda K H 0.335 0.143 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23121682173 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40