bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6626_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value 272633.MYPE9680 33.5 2.0 208963.PA14_58550 33.5 2.0 226185.EF1945 33.5 2.0 208964.PA4512 32.3 3.8 290402.Cbei_4474 32.3 4.1 9361.ENSDNOP00000015360 32.0 5.5 381754.PSPA7_5126 31.6 7.4 > 272633.MYPE9680 Length=768 Score = 33.5 bits (75), Expect = 2.0, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 6/33 (18%) Query 101 NGCVRNNIFEQLSR-----FASLFLPLLPLFFV 128 N ++ NIF Q+SR FAS+F+PL+PLF V Sbjct 107 NYSIKTNIF-QISRSGVRGFASIFIPLIPLFIV 138 > 208963.PA14_58550 Length=299 Score = 33.5 bits (75), Expect = 2.0, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Query 94 SLLVVHLNGCVRNNIFEQLSRFASLFLPLLPLFFVFCKFVNFAFHVRRVVLLPQ 147 S+L VH G VR+ + QLS +S P+ L ++F K N R L PQ Sbjct 12 SILYVHFRGRVRHKLSRQLSDHSSFLAPINCLMYLFSKVAN------RPYLAPQ 59 > 226185.EF1945 Length=611 Score = 33.5 bits (75), Expect = 2.0, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%) Query 10 FLLFVLFSLLLFLKCSKEYFVDCAFGFFF----------CFPLGVYLLFFVSINCSFFV 58 F+L ++FS L C VD AF F F CF L V+LLF S+ S V Sbjct 22 FILLIIFSNLYLQWCQNNLSVDLAFKFAFSWHTEKFFLGCFVLSVFLLFLCSLAGSLGV 80 > 208964.PA4512 Length=299 Score = 32.3 bits (72), Expect = 3.8, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Query 94 SLLVVHLNGCVRNNIFEQLSRFASLFLPLLPLFFVFCKFVNFAFHVRRVVLLPQ 147 S+L VH G VR+ + QLS +S P+ L ++F K N R L PQ Sbjct 12 SILYVHFRGRVRHKLSRQLSDHSSFLAPINCLMYLFSKVPN------RPYLAPQ 59 > 290402.Cbei_4474 Length=916 Score = 32.3 bits (72), Expect = 4.1, Method: Composition-based stats. Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 6/98 (6%) Query 4 GLPSE----LFLLFVLFSLLLFLKCSKEYFVDCAFGFFFCFPLGVYLLFFVSINCSFFVF 59 G SE LF LF +L C +E+ + F FF + + ++F + F Sbjct 816 GFASEMETVLFGLFAFSALFNAFNC-REFGAESIFPNFFKNKIAIQVIFITGLAQIIFTQ 874 Query 60 IFVFWFSKPFSLVLQWCRLGLGLLALRIVWQKICSLLV 97 +F +FS V+ W ++ LGL + IV ++ ++ Sbjct 875 VFTTFFSSVALSVIMWSKV-LGLAFMVIVVNEVIKFII 911 > 9361.ENSDNOP00000015360 Length=147 Score = 32.0 bits (71), Expect = 5.5, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 5/99 (5%) Query 1 ILFGLPSELFLLFVLFSLLLFLKCSKE--YFVDCAFGFFFCF---PLGVYLLFFVSINCS 55 +L +P + + +LFS +L + E +F+ AFG F PLG+YLL F+S +CS Sbjct 4 LLKAIPVSIHVNVILFSTILIILTMVETAFFMYNAFGKPFETLHGPLGLYLLSFISGSCS 63 Query 56 FFVFIFVFWFSKPFSLVLQWCRLGLGLLALRIVWQKICS 94 F V I K L + G A + +K + Sbjct 64 FLVMILFASEVKIHHLSEKIANYKEGTYAYKTQSEKYTT 102 > 381754.PSPA7_5126 Length=299 Score = 31.6 bits (70), Expect = 7.4, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 94 SLLVVHLNGCVRNNIFEQLSRFASLFLPLLPLFFVFCKFVNFAF 137 S+L VH G VR+ + QLS +S P+ L ++F K N + Sbjct 12 SILYVHFRGRVRHKLSRQLSDHSSFLAPVNCLMYLFSKVPNRPY 55 Lambda K H 0.345 0.156 0.537 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40