bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6554_orf2 Length=76 Score E Sequences producing significant alignments: (Bits) Value 30611.ENSOGAP00000005376 37.7 0.095 347834.RHE_CH02793 33.9 1.6 271848.BTH_I3332 32.7 3.3 366394.Smed_2011 31.6 6.9 > 30611.ENSOGAP00000005376 Length=760 Score = 37.7 bits (86), Expect = 0.095, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 0/67 (0%) Query 10 GRRERPDVRRALRRRLRRRVGRRRFRRRLRRSKSSSSSSRPRLGRARRSQRSQTAAARGA 69 G ++RP V +L R + ++ R +R L++ KS ++S P+ G+ R+ Q+ + A Sbjct 571 GPQKRPIVEFSLEDRRKLKIKELRIQRSLQKMKSKPATSEPQKGQPRKDQQQKAAQNHTK 630 Query 70 PQRGPPP 76 Q PPP Sbjct 631 EQSKPPP 637 > 347834.RHE_CH02793 Length=297 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 1 GLGFRVCNGGRRERPDVRRALRRRLRRRV 29 GL F+ GG + PD+ ALR LRRR+ Sbjct 107 GLYFKALTGGLSDMPDIPEALREELRRRL 135 > 271848.BTH_I3332 Length=561 Score = 32.7 bits (73), Expect = 3.3, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 0/67 (0%) Query 7 CNGGRRERPDVRRALRRRLRRRVGRRRFRRRLRRSKSSSSSSRPRLGRARRSQRSQTAAA 66 C GR + PD R R+R G R + + +S +++ P L A R+ A Sbjct 484 CRMGRADDPDAVVDSRLRVRGVTGLRIVDASVMPTITSGNTNSPTLMIAERASDMIRADR 543 Query 67 RGAPQRG 73 RGAP+RG Sbjct 544 RGAPERG 550 > 366394.Smed_2011 Length=305 Score = 31.6 bits (70), Expect = 6.9, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 1 GLGFRVCNGGRRERPDVRRALRRRLRRRV 29 GL F+ GG + P+V A+R+RLR+R+ Sbjct 107 GLYFKALTGGLSDMPEVPHAIRQRLRKRL 135 Lambda K H 0.326 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23163449821 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40