bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6532_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00026804001 36.6 0.21 51511.ENSCSAVP00000012261 33.9 1.6 8090.ENSORLP00000019627 33.5 2.1 31033.SINFRUP00000163728 32.3 4.5 224911.blr0943 31.6 6.6 > 99883.GSTENP00026804001 Length=777 Score = 36.6 bits (83), Expect = 0.21, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Query 61 WSGNCSRRLGRTT-DSPSYLAAAFSGILPVRLRIKRPDDQQ 100 WSG+ R LGR T DSPS +AAAF+G L + + P++++ Sbjct 214 WSGSMPRCLGRNTYDSPSDVAAAFTGSLAGLMDVLSPEEKK 254 > 51511.ENSCSAVP00000012261 Length=2002 Score = 33.9 bits (76), Expect = 1.6, Method: Compositional matrix adjust. Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 8/91 (8%) Query 1 ATNKIEFEYKRSEFSVLLEHRNSAFPMAPALQLLTASSIHPCLSVILKVAGRASNYNYTC 60 A+ K + + K+ + L ++ A P P T + I CLS + K+ YN C Sbjct 39 ASQKSDIKEKQEKLVEQLTNQILAGPGPP-----TRALIGHCLSTLYKIGDSFGIYNSVC 93 Query 61 WSGNCSRRLGRTTDSPSYLAAAFSGILPVRL 91 C L DSPSYL+ + I+ V + Sbjct 94 ---KCHDVLKSKDDSPSYLSVRLAAIVVVGI 121 > 8090.ENSORLP00000019627 Length=728 Score = 33.5 bits (75), Expect = 2.1, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query 61 WSGNCSRRLG-RTTDSPSYLAAAFSGILPVRLRIKRPD 97 WSG+ R G T DSPSY+AAA +G L + + PD Sbjct 157 WSGSTPRCQGPNTFDSPSYVAAAMAGSLAGVMDVVSPD 194 > 31033.SINFRUP00000163728 Length=774 Score = 32.3 bits (72), Expect = 4.5, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 61 WSGNCSRRLGRTT-DSPSYLAAAFSGILPVRLRIKRPDDQQ 100 WSG+ R LGR T DSPS +A A +G L + + P++++ Sbjct 216 WSGSMPRCLGRNTYDSPSDVAKAMTGSLAGLMDVLSPEEKK 256 > 224911.blr0943 Length=156 Score = 31.6 bits (70), Expect = 6.6, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Query 42 CLSVILKVAGRASNYNYTCWSGNCSRRLGRTTDSPSYLAAAFSGILPVRLRIKRPDDQQV 101 C +V +VA + S Y C NC R G + P F+GI +LRI R DDQ++ Sbjct 32 CRAVRYEVADQFS-YAMNCHCSNCRRTTG-SAFKP------FAGIAQEKLRIVRGDDQRI 83 Query 102 LLLLD 106 + D Sbjct 84 IFGDD 88 Lambda K H 0.320 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40