bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6517_orf2 Length=154 Score E Sequences producing significant alignments: (Bits) Value 228405.HNE_2681 32.7 3.6 326424.FRAAL5564 32.3 4.1 405948.SACE_6847 32.0 5.5 9606.ENSP00000322899 31.6 6.9 349161.Dred_2576 31.2 9.1 > 228405.HNE_2681 Length=475 Score = 32.7 bits (73), Expect = 3.6, Method: Composition-based stats. Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Query 64 CEQGVVAEEVAEEVAEEVAKEVEGAEGGVSNEEAQRAREEAVQAFRDYITARTAAALRAA 123 C + V E ++E V KEV G+ GG A ++ ++AFR + AR AA + Sbjct 349 CSEPSSLAYVLEHLSELVVKEVHGS-GGYGMLVGPAASKKEIEAFRAKLQARPAAYIAQP 407 Query 124 EFLATAARLTHQCGIVPHDED 144 + + + G+ P D Sbjct 408 TLALSTVPILSRAGLAPRHVD 428 > 326424.FRAAL5564 Length=193 Score = 32.3 bits (72), Expect = 4.1, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Query 67 GVVAEEVAEE--VAEEVAKEVEGAEGGVSNEEAQRAREEAVQAFRDYITARTAA 118 G V E+ E VA VA++ A+G VS+E + A VQA D+++AR +A Sbjct 133 GYVTAEMIEPACVAIPVARDAVAADGTVSDEAVRAALGATVQAITDHLSARNSA 186 > 405948.SACE_6847 Length=1984 Score = 32.0 bits (71), Expect = 5.5, Method: Composition-based stats. Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Query 68 VVAEEVAEEVAEEVAK--EVEGAEGGVSNEEAQRAR---EEAVQAFRDYITARTAAALRA 122 V AEE+ E E+AK EV GA+G V E + +R E AF TAR + A Sbjct 1702 VDAEEIEAERLRELAKAEEVAGADGAVPRGEGELSRVATAEDAAAFERLCTARPDLFVPA 1761 Query 123 AEFLATAARLTH 134 A AR+ H Sbjct 1762 APDELVRARVAH 1773 > 9606.ENSP00000322899 Length=348 Score = 31.6 bits (70), Expect = 6.9, Method: Compositional matrix adjust. Identities = 31/77 (40%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Query 72 EVAE-EVAEEVAKEVEGAEGGVSNEEAQRAREEAVQAFRDYITARTAAALRAAEFLATA- 129 EVA+ A + A + EGA G S A R EAVQA AR A+ RAA L A Sbjct 249 EVAQVPPATQPAAQQEGAMGPRSCASAGRDSREAVQAPGYPEPARKASQHRAAGPLGEAR 308 Query 130 ARLTHQCGIVPHDEDEQ 146 ARL QC P + Sbjct 309 ARLQRQCRAPPPPSNPH 325 > 349161.Dred_2576 Length=240 Score = 31.2 bits (69), Expect = 9.1, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 60 DEGACEQGVVAEEVAEEVAEEVAKEVEG 87 D GAC +G++ +++ +A+ VAK +EG Sbjct 66 DPGACREGIMEKDINLAIAKRVAKHIEG 93 Lambda K H 0.317 0.128 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23121682173 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40