bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6255_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value 9615.ENSCAFP00000018162 32.3 4.3 216596.RL2798 32.3 4.5 > 9615.ENSCAFP00000018162 Length=736 Score = 32.3 bits (72), Expect = 4.3, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Query 34 HPPGVIVRPDNRNRHIMTLSSFKAPTTSPEGPPARRRNLRSGEHSDLVTARTLSQTETEK 93 HP +V + R + L +F A T PEG AR R + + ++ VT LS T T + Sbjct 371 HPRSFVVSEADGARPGIQLGAFNA--TDPEGAVARIRYKLAYDPANWVTVDELSGTVTTR 428 Query 94 GQIER 98 QI+R Sbjct 429 QQIDR 433 > 216596.RL2798 Length=838 Score = 32.3 bits (72), Expect = 4.5, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Query 64 GPPARRRNLRSGEHSDLVTARTLSQTETEKGQIER 98 G PA R +R+G H D+ T R + ET +GQ++R Sbjct 82 GLPAERHAMRTGVHPDITTKRNI---ETFRGQVQR 113 Lambda K H 0.309 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40