bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5922_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 5270.cox1 33.1 2.8 > 5270.cox1 Length=528 Score = 33.1 bits (74), Expect = 2.8, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 7/67 (10%) Query 8 FQAVASLGLFFYFFFNFFFFFNYRVNLIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YF 66 F V S+G F F F+F+ I +F+E + I F LF+ GV+L FFP +F Sbjct 376 FHYVLSMGAVFALFGGFYFW----TPKIIGKTFNENLGRIHFWTLFV--GVNLTFFPQHF 429 Query 67 LNFGGFP 73 L GG P Sbjct 430 LGLGGMP 436 Lambda K H 0.342 0.155 0.514 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40