bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5920_orf1 Length=83 Score E Sequences producing significant alignments: (Bits) Value 257311.BPP3902 32.7 3.3 257310.BB4375 32.7 3.3 196162.Noca_3159 32.0 5.7 351607.Acel_1443 32.0 6.1 > 257311.BPP3902 Length=1165 Score = 32.7 bits (73), Expect = 3.3, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 16 GVSHLQLHQAVHQTGLIIIRRQATAILHYPQCSWPLVG 53 G +HL +A+H+ GL + QA ++ P +WPL G Sbjct 292 GKAHLDTMEALHRLGLDTVGAQAPVRIYKPGLTWPLDG 329 > 257310.BB4375 Length=1168 Score = 32.7 bits (73), Expect = 3.3, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 16 GVSHLQLHQAVHQTGLIIIRRQATAILHYPQCSWPLVG 53 G +HL +A+H+ GL + QA ++ P +WPL G Sbjct 292 GKAHLDTMEALHRLGLDTVGAQAPVRIYKPGLTWPLDG 329 > 196162.Noca_3159 Length=306 Score = 32.0 bits (71), Expect = 5.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 35 RRQATAILHYPQCSWPLVGALDWTHYGKVAVSVLPL 70 R++ ++I +YP +W VGA+ W G V+ +PL Sbjct 97 RQKYSSIFNYPTLTWADVGAIGWLVDGAAIVNQVPL 132 > 351607.Acel_1443 Length=320 Score = 32.0 bits (71), Expect = 6.1, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Query 16 GVSHLQLHQAVHQTGLIIIRRQATAILHYPQCSWPLVGALDWTHYGKVAVSVLPL 70 GVS +L + +H +++ ++I +YP +W VGA+ W G + +PL Sbjct 98 GVSRAELFELLHSR-----KQKYSSIFNYPTLTWADVGAIGWLVDGAAITNQVPL 147 Lambda K H 0.328 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22659344793 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40