bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5425_orf8 Length=52 Score E Sequences producing significant alignments: (Bits) Value 56780.SYN_02795 34.7 0.94 99883.GSTENP00024444001 33.1 2.6 > 56780.SYN_02795 Length=417 Score = 34.7 bits (78), Expect = 0.94, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query 4 EAVLRSRERSKVIRQLQTGIPEVVHDTAFPTGV--TTFAPHARLHG 47 +A L + E + VIR LQ I EV AFP G+ T A H R G Sbjct 329 QAALPTSENAPVIRALQNAIKEVYSAEAFPGGIGGGTVAAHFRKQG 374 > 99883.GSTENP00024444001 Length=90 Score = 33.1 bits (74), Expect = 2.6, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 0/34 (0%) Query 15 VIRQLQTGIPEVVHDTAFPTGVTTFAPHARLHGI 48 ++ QL G +V AFP G+ +APHA H I Sbjct 57 ILFQLVQGFLHIVQPNAFPQGMDLYAPHALYHAI 90 Lambda K H 0.322 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23041036467 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40