bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5425_orf6 Length=57 Score E Sequences producing significant alignments: (Bits) Value 354242.CJJ81176_1330 32.0 4.9 195099.CJE1508 32.0 4.9 > 354242.CJJ81176_1330 Length=157 Score = 32.0 bits (71), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query 1 FDSCKLGSLKSYMTQLSRQVLRHSHRMHAFTAYSAENKYVQICMLYQQCLGLS 53 F++ K+ +LK+Y+ + +R+ L+ + H FT Y + + IC+ C L Sbjct 105 FENLKVNTLKAYVFKDNRKALKLYQQNH-FTIYDEDKDFYHICLKQSDCKALP 156 > 195099.CJE1508 Length=157 Score = 32.0 bits (71), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query 1 FDSCKLGSLKSYMTQLSRQVLRHSHRMHAFTAYSAENKYVQICMLYQQCLGLS 53 F++ K+ +LK+Y+ + +R+ L+ + H FT Y + + IC+ C L Sbjct 105 FENLKVNTLKAYVFKDNRKALKLYQQNH-FTIYDEDKDFYHICLKQSDCKALP 156 Lambda K H 0.326 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22705794207 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40