bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5218_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000056812 33.9 1.4 5671.LinJ34.1640 33.1 2.4 > 7955.ENSDARP00000056812 Length=841 Score = 33.9 bits (76), Expect = 1.4, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Query 16 SWSSPCPGISTLTSTPPRWYEAPLSRNSLIIWYINVNILTYVLSLIYTQTHWSKCFCVNQ 75 +W +P STPP+ A ++ + +YI+ +I+TY +T S C+N Sbjct 592 TWETPTCNAGVRCSTPPKVVNALITSKPKL-FYIDKSIVTYACRSPFTMKGQSTVSCLNG 650 Query 76 KPFDSIVCYAKQAR 89 K ++ +C AK R Sbjct 651 KWEETPICEAKCPR 664 > 5671.LinJ34.1640 Length=416 Score = 33.1 bits (74), Expect = 2.4, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Query 23 GISTLTSTPPRWYEAPLSRNSLIIWYINVNILTYVLSLIYTQTHWSKCFCV--NQKPFD 79 GIS ++TPPR + APLS S + +LT +SL + +T K C N+ P D Sbjct 3 GISIRSATPPRRHNAPLSAES------ELTVLTAGVSLAHEETCTRKVACTVFNRTPAD 55 Lambda K H 0.328 0.138 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40