bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5217_orf2 Length=110 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL008757-PA 33.1 2.5 9913.ENSBTAP00000025881 32.0 5.0 267747.PPA1718 31.6 8.1 > 7159.AAEL008757-PA Length=555 Score = 33.1 bits (74), Expect = 2.5, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 77 PHSHPCSRVEGCWTAAANTGDPGVSKGV 104 P S R+ G WTA A TGDP +G+ Sbjct 482 PESKTVERLTGMWTAFARTGDPNAVQGI 509 > 9913.ENSBTAP00000025881 Length=349 Score = 32.0 bits (71), Expect = 5.0, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query 37 GQLQDQQQQQQQQQRSSSARRPRLPVAPLSPGATRLR-PPPPHSHPCSRVEGCWTAAAN 94 GQ Q+ + R S +P+SP ++ PP PHS PC +V+ C+ +++ Sbjct 66 GQSHHSQKDEIPYARCSYPPSAVATESPVSPALNGVKVPPRPHSEPCRKVKECFKTSSD 124 > 267747.PPA1718 Length=85 Score = 31.6 bits (70), Expect = 8.1, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 0/52 (0%) Query 35 VAGQLQDQQQQQQQQQRSSSARRPRLPVAPLSPGATRLRPPPPHSHPCSRVE 86 + Q+QD+ + Q S ARR RLP P + PH HPC++ E Sbjct 1 MTSQVQDELWCRHDDQASGLARRLRLPTTTTPPIYGKASQQDPHCHPCNQNE 52 Lambda K H 0.318 0.136 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40