bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5044_orf3 Length=62 Score E Sequences producing significant alignments: (Bits) Value 340322.cgR_1306 31.2 8.1 > 340322.cgR_1306 Length=387 Score = 31.2 bits (69), Expect = 8.1, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Query 1 CGESGARGEPPAVRTPRARLLRTYTAANA-----CCQAATQLFQFFRASAHLPASQTAFS 55 C ES + PPAV RAR L+T NA C T+ + A S FS Sbjct 71 CQESAQQTTPPAVSAERARRLKTALGENAIVHDVTCSIGTEGHELIDAGLRYLGSDLDFS 130 Query 56 AT 57 T Sbjct 131 RT 132 Lambda K H 0.324 0.128 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22370551947 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40