bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5025_orf3 Length=107 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000005748 32.0 6.0 > 42254.ENSSARP00000005748 Length=1042 Score = 32.0 bits (71), Expect = 6.0, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Query 18 QLQQQQMGPPAWAACSPLRLRSSKATAATRXAPYQPQQDPSLLLLLLLLLLQQCCGLDSA 77 Q+ Q +MGPP ++ SPL + + + + PYQP +P LL ++ G + Sbjct 709 QMPQAEMGPPPFS--SPLVMPPPQVSESHGQIPYQPDLEPESSGQLLQAEYEESLGGKNL 766 Query 78 SSQPLAAP 85 QP P Sbjct 767 FPQPSFGP 774 Lambda K H 0.324 0.132 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40