bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4873_orf2 Length=121 Score E Sequences producing significant alignments: (Bits) Value 351607.Acel_0227 31.6 8.2 > 351607.Acel_0227 Length=976 Score = 31.6 bits (70), Expect = 8.2, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 0/32 (0%) Query 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPF 36 G P +FFA G PF GF+G RFP+ Sbjct 381 GYPLRLAVFFALGTLPFLCYGFIGYLDRRFPY 412 Lambda K H 0.333 0.159 0.588 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40