bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4821_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value 279238.Saro_1789 33.1 2.2 > 279238.Saro_1789 Length=144 Score = 33.1 bits (74), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query 17 RGRDSEWDCSTPDETKWRAQSVGRVDTAAGGMFASLKMGILHGVLTDCNVGTAF-YLQSR 75 RG+D E PDE W+A + + +A++ + + G +VG A+ Y+ R Sbjct 45 RGQDLE--GVLPDEINWKAHNYAHLMEQPTLFYATVAILAIQGAAGPLDVGLAWAYVVLR 102 Query 76 VLHSI 80 V+HS+ Sbjct 103 VIHSV 107 Lambda K H 0.320 0.129 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40