bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4088_orf2 Length=95 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000090596 38.5 0.066 272620.KPN_01122 31.6 6.3 > 7955.ENSDARP00000090596 Length=1013 Score = 38.5 bits (88), Expect = 0.066, Method: Composition-based stats. Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 11/89 (12%) Query 6 QDRRSRIDVRVLTDLFVSRVRTPLPLSAVERAVVFLEGIFPATIQLRSNVIT-----VDP 60 Q+ R +D+R L D SR TP L ER V L + LR NV+T +D Sbjct 272 QEGRDGVDLRRLQDESCSRSSTPAGLDGTERVYVML------NVSLRVNVLTFSVSEMDF 325 Query 61 SIDHLSVKKVVDSKLREAQEAALAADAKK 89 S+ L + K+++A E+ +AA+ +K Sbjct 326 SLLSLCFADMEVQKMKKAMESLMAANEEK 354 > 272620.KPN_01122 Length=572 Score = 31.6 bits (70), Expect = 6.3, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Query 41 LEGIFPATIQLRSNVITVDPS--IDHLSVKKVVDSKLREAQEAALAADAKKG 90 ++ I A + L NV+TVDP + L+V++ + + R + A+L AD ++G Sbjct 330 VDAIAGAVVALNWNVLTVDPGPFTERLAVRRGLMREARSSAPASLTADGQRG 381 Lambda K H 0.321 0.135 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22621220430 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40